| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
| Domain d1ml5o_: 1ml5 O: [79270] also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x termination complex with release factor 2 |
PDB Entry: 1ml5 (more details)
SCOPe Domain Sequences for d1ml5o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml5o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea
Timeline for d1ml5o_: