Class a: All alpha proteins [46456] (202 folds) |
Fold a.171: BRCA2 tower domain [81877] (1 superfamily) multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices |
Superfamily a.171.1: BRCA2 tower domain [81878] (1 family) |
Family a.171.1.1: BRCA2 tower domain [81879] (1 protein) |
Protein BRCA2 tower domain [81880] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81881] (2 PDB entries) |
Domain d1mjea2: 1mje A:2752-2887 [79194] Other proteins in same PDB: d1mjea1, d1mjea3, d1mjea4, d1mjea5 this domain is partly disordered in the crystal structure |
PDB Entry: 1mje (more details), 3.5 Å
SCOP Domain Sequences for d1mjea2:
Sequence, based on SEQRES records: (download)
>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus)} vektvsglyifrsereeekealrfaeaqqkklealftkvhteglsrdvt
>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus)} vektvsglyifrsereeekealrfaeaqqkklealftkvhtlsrdvt
Timeline for d1mjea2:
View in 3D Domains from same chain: (mouse over for more information) d1mjea1, d1mjea3, d1mjea4, d1mjea5 |