Lineage for d1mjea2 (1mje A:2752-2887)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362259Fold a.171: BRCA2 tower domain [81877] (1 superfamily)
    multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices
  4. 362260Superfamily a.171.1: BRCA2 tower domain [81878] (1 family) (S)
  5. 362261Family a.171.1.1: BRCA2 tower domain [81879] (1 protein)
  6. 362262Protein BRCA2 tower domain [81880] (2 species)
  7. 362263Species Mouse (Mus musculus) [TaxId:10090] [81881] (2 PDB entries)
  8. 362265Domain d1mjea2: 1mje A:2752-2887 [79194]
    Other proteins in same PDB: d1mjea1, d1mjea3, d1mjea4, d1mjea5
    this domain is partly disordered in the crystal structure

Details for d1mjea2

PDB Entry: 1mje (more details), 3.5 Å

PDB Description: structure of a brca2-dss1-ssdna complex

SCOP Domain Sequences for d1mjea2:

Sequence, based on SEQRES records: (download)

>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus)}
vektvsglyifrsereeekealrfaeaqqkklealftkvhteglsrdvt

Sequence, based on observed residues (ATOM records): (download)

>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus)}
vektvsglyifrsereeekealrfaeaqqkklealftkvhtlsrdvt

SCOP Domain Coordinates for d1mjea2:

Click to download the PDB-style file with coordinates for d1mjea2.
(The format of our PDB-style files is described here.)

Timeline for d1mjea2: