SCOPe 2.04: Domain d1mjba_: 1mjb A:

Lineage for d1mjba_ (1mjb A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Histone acetyltransferase ESA1 [55744] (1 species)
   most similar to HAT1 including the N- and C-terminal (sub)domains; the N-terminal domain contains a rudiment CCHC zinc-finger (res. 191-220); the C-terminal domain (res. 351-434) has "winged helix" DNA-binding fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55745] (4 PDB entries)

8. Domain d1mjba_: 1mjb A: [79192]
   complexed with aco; mutant

Details for d1mjba_

PDB Entry: 1mjb, 2.5 Å

PDB Description: Crystal structure of yeast Esa1 histone acetyltransferase E338Q mutant complexed with acetyl coenzyme A

PDB Compounds: (A:) Esa1 protein

SCOPe Domain Sequences for d1mjba_:

Sequence; same for both SEQRES and ATOM records:

>d1mjba_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
arvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkctlr
hppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrrde
lghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqkpl
sdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykgqh
iiflnedildrynrlkakkrrtidpnrliwkpp

Timeline for d1mjba_:

• d1mjba_ first appeared in SCOP 1.63
  
• d1mjba_ appears in SCOPe 2.03
  
• d1mjba_ appears in SCOPe 2.05
  
• d1mjba_ appears in the current release, SCOPe 2.08