Class a: All alpha proteins [46456] (289 folds) |
Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily) multihelical; can be divided into three subdomains (neck, body and tail) |
Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like |
Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins) the 'neck' domain corresponds to the C-terminal part of Pfam PF01743 |
Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries) |
Domain d1mivb1: 1miv B:140-404 [79160] Other proteins in same PDB: d1miva2, d1mivb2 complexed with mg |
PDB Entry: 1miv (more details), 3.5 Å
SCOPe Domain Sequences for d1mivb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mivb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]} iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn gevenekeriyawlmernrtreknc
Timeline for d1mivb1: