Lineage for d1miua2 (1miu A:2752-2887)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507594Fold a.171: BRCA2 tower domain [81877] (1 superfamily)
    multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices
  4. 1507595Superfamily a.171.1: BRCA2 tower domain [81878] (1 family) (S)
  5. 1507596Family a.171.1.1: BRCA2 tower domain [81879] (1 protein)
  6. 1507597Protein BRCA2 tower domain [81880] (2 species)
  7. 1507598Species Mouse (Mus musculus) [TaxId:10090] [81881] (2 PDB entries)
  8. 1507599Domain d1miua2: 1miu A:2752-2887 [79154]
    Other proteins in same PDB: d1miua1, d1miua3, d1miua4, d1miua5
    protein/DNA complex; complexed with hg

Details for d1miua2

PDB Entry: 1miu (more details), 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex
PDB Compounds: (A:) Breast Cancer type 2 susceptibility protein

SCOPe Domain Sequences for d1miua2:

Sequence, based on SEQRES records: (download)

>d1miua2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus) [TaxId: 10090]}
vektvsglyifrsereeekealrfaeaqqkklealftkvhtefkdheedttqrcvlsrtl
trqqvhalqdgaelyaavqyasdpdhleacfseeqlralnnyrqmlndkkqariqsefrk
alesaekeeglsrdvt

Sequence, based on observed residues (ATOM records): (download)

>d1miua2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus) [TaxId: 10090]}
vektvsglyifrsereeekealrfaeaqqkklealftkvhtefksrtltrqqvhalqdga
elyaavqyasdpdhleacfseeqlralnnyrqmlndkkqariqsefrkalesaekeegls
rdvt

SCOPe Domain Coordinates for d1miua2:

Click to download the PDB-style file with coordinates for d1miua2.
(The format of our PDB-style files is described here.)

Timeline for d1miua2: