![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.170: BRCA2 helical domain [81871] (1 superfamily) multihelical; contains a 3-helical bundle surrounded by several shorter helices |
![]() | Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) ![]() automatically mapped to Pfam PF09169 |
![]() | Family a.170.1.1: BRCA2 helical domain [81873] (1 protein) |
![]() | Protein BRCA2 helical domain [81874] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [81875] (2 PDB entries) |
![]() | Domain d1miua1: 1miu A:2399-2589 [79153] Other proteins in same PDB: d1miua2, d1miua3, d1miua4, d1miua5, d1miub_ complexed with human Dss1 fragment, chain B protein/DNA complex; complexed with hg |
PDB Entry: 1miu (more details), 3.1 Å
SCOPe Domain Sequences for d1miua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miua1 a.170.1.1 (A:2399-2589) BRCA2 helical domain {Mouse (Mus musculus) [TaxId: 10090]} kdlmsslqsardlqdmriknkerrhlrlqpgslyltksstlprislqaavgdrapsacsp kqlyiygvskecinvnsknaeyfqfdiqdhfgkedlcagkgfqladggwlipsndgkagk eefyralcdtpgvdpklissiwvanhyrwivwklaamefafpkefanrclnpervllqlk yrydveidnsr
Timeline for d1miua1:
![]() Domains from same chain: (mouse over for more information) d1miua2, d1miua3, d1miua4, d1miua5 |