Lineage for d1mg2c_ (1mg2 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043109Protein Amicyanin [49505] (2 species)
  7. 2043110Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2043154Domain d1mg2c_: 1mg2 C: [79061]
    Other proteins in same PDB: d1mg2a_, d1mg2b_, d1mg2d_, d1mg2e_, d1mg2f_, d1mg2h_, d1mg2i_, d1mg2j_, d1mg2l_, d1mg2m_, d1mg2n_, d1mg2p_
    complexed with cu, hem, na, po4; mutant

Details for d1mg2c_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (C:) amicyanin

SCOPe Domain Sequences for d1mg2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2c_ b.6.1.1 (C:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1mg2c_:

Click to download the PDB-style file with coordinates for d1mg2c_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2c_: