Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries) Uniprot P20065 55-179 |
Domain d1mdud_: 1mdu D: [79017] Other proteins in same PDB: d1mdub1, d1mdub2, d1mdue1, d1mdue2 domain 1 complexed with atp, ca, trs |
PDB Entry: 1mdu (more details), 2.2 Å
SCOPe Domain Sequences for d1mdud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdud_ d.109.1.1 (D:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva sgf
Timeline for d1mdud_: