Lineage for d1mdub1 (1mdu B:7-146)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171259Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry)
    sequence identical to the rabbit actin
  8. 1171260Domain d1mdub1: 1mdu B:7-146 [79015]
    Other proteins in same PDB: d1mdua_, d1mdud_
    complexed with atp, ca, trs

Details for d1mdub1

PDB Entry: 1mdu (more details), 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)
PDB Compounds: (B:) a-actin

SCOPe Domain Sequences for d1mdub1:

Sequence, based on SEQRES records: (download)

>d1mdub1 c.55.1.1 (B:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslya

Sequence, based on observed residues (ATOM records): (download)

>d1mdub1 c.55.1.1 (B:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprgqkdsyvgdeaqskrgiltlkypie
hgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpam
yvaiqavlslya

SCOPe Domain Coordinates for d1mdub1:

Click to download the PDB-style file with coordinates for d1mdub1.
(The format of our PDB-style files is described here.)

Timeline for d1mdub1: