| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
| Protein Pax-5 [68962] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries) |
| Domain d1mdma2: 1mdm A:82-142 [79011] Other proteins in same PDB: d1mdmb_ protein/DNA complex |
PDB Entry: 1mdm (more details), 2.8 Å
SCOPe Domain Sequences for d1mdma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdma2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]}
viggskpkvatpkvvekiaeykrqnptmfaweirdrllaervcdndtvpsvssinriirt
k
Timeline for d1mdma2: