SCOP 1.69: Domain d1mczi2: 1mcz I:2-181

Lineage for d1mczi2 (1mcz I:2-181)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Benzoylformate decarboxylase [88731] (1 species)

7. Species Pseudomonas putida [TaxId:303] [88732] (2 PDB entries)

8. Domain d1mczi2: 1mcz I:2-181 [78977]
   Other proteins in same PDB: d1mcza1, d1mcza3, d1mczb1, d1mczb3, d1mczc1, d1mczc3, d1mczd1, d1mczd3, d1mcze1, d1mcze3, d1mczf1, d1mczf3, d1mczg1, d1mczg3, d1mczh1, d1mczh3, d1mczi1, d1mczi3, d1mczj1, d1mczj3, d1mczk1, d1mczk3, d1mczl1, d1mczl3, d1mczm1, d1mczm3, d1mczn1, d1mczn3, d1mczo1, d1mczo3, d1mczp1, d1mczp3

Details for d1mczi2

PDB Entry: 1mcz, 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

SCOP Domain Sequences for d1mczi2:

Sequence; same for both SEQRES and ATOM records:

>d1mczi2 c.36.1.5 (I:2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

Timeline for d1mczi2:

• d1mczi2 first appeared in SCOP 1.63
  
• d1mczi2 appears in SCOP 1.67
  
• d1mczi2 appears in SCOP 1.71
  
• d1mczi2 appears in the current release, SCOPe 2.08