Lineage for d1mczi2 (1mcz I:2-181)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581038Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 581055Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 581056Species Pseudomonas putida [TaxId:303] [88732] (5 PDB entries)
  8. 581069Domain d1mczi2: 1mcz I:2-181 [78977]
    Other proteins in same PDB: d1mcza1, d1mcza3, d1mczb1, d1mczb3, d1mczc1, d1mczc3, d1mczd1, d1mczd3, d1mcze1, d1mcze3, d1mczf1, d1mczf3, d1mczg1, d1mczg3, d1mczh1, d1mczh3, d1mczi1, d1mczi3, d1mczj1, d1mczj3, d1mczk1, d1mczk3, d1mczl1, d1mczl3, d1mczm1, d1mczm3, d1mczn1, d1mczn3, d1mczo1, d1mczo3, d1mczp1, d1mczp3

Details for d1mczi2

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

SCOP Domain Sequences for d1mczi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczi2 c.36.1.5 (I:2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1mczi2:

Click to download the PDB-style file with coordinates for d1mczi2.
(The format of our PDB-style files is described here.)

Timeline for d1mczi2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3