SCOPe 2.08: Domain d1mc0a1: 1mc0 A:215-401

Lineage for d1mc0a1 (1mc0 A:215-401)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains [82760] (1 species)
   GAF B is the nucleotide binding domain; the two domains are connected with a long helix;

7. Species Mouse (Mus musculus) [TaxId:10090] [82761] (1 PDB entry)

8. Domain d1mc0a1: 1mc0 A:215-401 [78937]
   complexed with pcg

Details for d1mc0a1

PDB Entry: 1mc0, 2.86 Å

PDB Description: Regulatory Segment of Mouse 3',5'-Cyclic Nucleotide Phosphodiesterase 2A, Containing the GAF A and GAF B Domains

PDB Compounds: (A:) 3',5'-cyclic nucleotide phosphodiesterase 2A

SCOPe Domain Sequences for d1mc0a1:

Sequence; same for both SEQRES and ATOM records:

>d1mc0a1 d.110.2.1 (A:215-401) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]}
ytdhdrkilqlcgelfdldatslqlkvlqylqqetqathcclllvsednlqlsckvigdk
vlgeevsfpltmgrlgqvvedkqciqlkdltsddvqqlqnmlgcelqamlcvpvisratd
qvvalacafnklggdfftdedehviqhcfhytgtvltstlafqkeqklkcecqallqvak
nlfthld

Timeline for d1mc0a1:

• d1mc0a1 first appeared in SCOP 1.63
  
• d1mc0a1 appears in SCOPe 2.07