| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (2 families) ![]() Serine/threonine protein kinase-associated motif embedded in two distinct folds |
| Family d.223.1.1: Swapped Polo-box domain [82616] (1 protein) beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5] |
| Protein Serine/threonine-protein kinase Sak C-terminal domain [82617] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [82618] (1 PDB entry) |
| Domain d1mbyb_: 1mby B: [78932] mutant |
PDB Entry: 1mby (more details), 2 Å
SCOP Domain Sequences for d1mbyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbyb_ d.223.1.1 (B:) Serine/threonine-protein kinase Sak C-terminal domain {Mouse (Mus musculus)}
svfvknvgwatqltsgavwvqfndgsqlvmqagvssisytspdgqttrygeneklpeyik
qklqllssillmfsn
Timeline for d1mbyb_: