Lineage for d1mbyb_ (1mby B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516363Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 516364Superfamily d.223.1: Polo-box domain [82615] (2 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 516365Family d.223.1.1: Swapped Polo-box domain [82616] (1 protein)
    beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5]
  6. 516366Protein Serine/threonine-protein kinase Sak C-terminal domain [82617] (1 species)
  7. 516367Species Mouse (Mus musculus) [TaxId:10090] [82618] (1 PDB entry)
  8. 516369Domain d1mbyb_: 1mby B: [78932]

Details for d1mbyb_

PDB Entry: 1mby (more details), 2 Å

PDB Description: murine sak polo domain

SCOP Domain Sequences for d1mbyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbyb_ d.223.1.1 (B:) Serine/threonine-protein kinase Sak C-terminal domain {Mouse (Mus musculus)}
svfvknvgwatqltsgavwvqfndgsqlvmqagvssisytspdgqttrygeneklpeyik
qklqllssillmfsn

SCOP Domain Coordinates for d1mbyb_:

Click to download the PDB-style file with coordinates for d1mbyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mbyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mbya_