Lineage for d1mbud_ (1mbu D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648110Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1648111Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1648135Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 1648136Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 1648137Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)
  8. 1648144Domain d1mbud_: 1mbu D: [78924]
    Other proteins in same PDB: d1mbua_, d1mbub_
    complex with ClpA N-domain
    complexed with cl, gol, ybt

Details for d1mbud_

PDB Entry: 1mbu (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of ClpSN heterodimer
PDB Compounds: (D:) Protein yljA

SCOPe Domain Sequences for d1mbud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbud_ d.45.1.2 (D:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1mbud_:

Click to download the PDB-style file with coordinates for d1mbud_.
(The format of our PDB-style files is described here.)

Timeline for d1mbud_: