Lineage for d1ma9a1 (1ma9 A:1-198)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098092Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1098093Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1098094Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1098255Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1098256Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1098266Domain d1ma9a1: 1ma9 A:1-198 [78887]
    Other proteins in same PDB: d1ma9b1, d1ma9b2
    complexed with atp, mg

Details for d1ma9a1

PDB Entry: 1ma9 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin
PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1ma9a1:

Sequence, based on SEQRES records: (download)

>d1ma9a1 a.126.1.1 (A:1-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
vcflkerlqlkhlslltt

Sequence, based on observed residues (ATOM records): (download)

>d1ma9a1 a.126.1.1 (A:1-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctlcmaalkhqpqefptyveptnde
iceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflker
lqlkhlslltt

SCOPe Domain Coordinates for d1ma9a1:

Click to download the PDB-style file with coordinates for d1ma9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ma9a1: