Lineage for d1m98b1 (1m98 B:2-175)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101229Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 1101230Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (1 family) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
  5. 1101231Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (1 protein)
  6. 1101232Protein Orange carotenoid protein, N-terminal domain [81932] (1 species)
  7. 1101233Species Arthrospira maxima [TaxId:129910] [81933] (1 PDB entry)
  8. 1101235Domain d1m98b1: 1m98 B:2-175 [78868]
    Other proteins in same PDB: d1m98a2, d1m98b2
    complexed with cl, heq, suc

Details for d1m98b1

PDB Entry: 1m98 (more details), 2.1 Å

PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (B:) Orange Carotenoid Protein

SCOPe Domain Sequences for d1m98b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m98b1 a.175.1.1 (B:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]}
pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva

SCOPe Domain Coordinates for d1m98b1:

Click to download the PDB-style file with coordinates for d1m98b1.
(The format of our PDB-style files is described here.)

Timeline for d1m98b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m98b2