Lineage for d1m8qh_ (1m8q H:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1071601Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 1071602Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 1071603Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 1071608Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 1071609Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 1071678Domain d1m8qh_: 1m8q H: [78802]

Details for d1m8qh_

PDB Entry: 1m8q (more details), 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (H:) Skeletal muscle Myosin II Regulatory Light Chain

SCOPe Domain Sequences for d1m8qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8qh_ i.15.1.1 (H:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

SCOPe Domain Coordinates for d1m8qh_:

Click to download the PDB-style file with coordinates for d1m8qh_.
(The format of our PDB-style files is described here.)

Timeline for d1m8qh_: