Lineage for d1m8pa2 (1m8p A:171-390)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590670Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 1590671Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 1590687Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63982] (2 PDB entries)
  8. 1590688Domain d1m8pa2: 1m8p A:171-390 [78778]
    Other proteins in same PDB: d1m8pa1, d1m8pa3, d1m8pb1, d1m8pb3, d1m8pc1, d1m8pc3
    complexed with pps

Details for d1m8pa2

PDB Entry: 1m8p (more details), 2.6 Å

PDB Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1m8pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8pa2 c.26.1.5 (A:171-390) ATP sulfurylase catalytic domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
yvalrytpaelrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvglt
kpgdidhftrvrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfiv
grdhagpgsnskgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpa
gvktlnisgtelrrrlrsgahipewfsypevvkilresnp

SCOPe Domain Coordinates for d1m8pa2:

Click to download the PDB-style file with coordinates for d1m8pa2.
(The format of our PDB-style files is described here.)

Timeline for d1m8pa2: