Lineage for d1m8pa1 (1m8p A:1-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823936Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 2823937Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 2823953Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries)
  8. 2823954Domain d1m8pa1: 1m8p A:1-170 [78777]
    Other proteins in same PDB: d1m8pa2, d1m8pa3, d1m8pb2, d1m8pb3, d1m8pc2, d1m8pc3
    complexed with pps

Details for d1m8pa1

PDB Entry: 1m8p (more details), 2.6 Å

PDB Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1m8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8pa1 b.122.1.3 (A:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn
qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid
diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd

SCOPe Domain Coordinates for d1m8pa1:

Click to download the PDB-style file with coordinates for d1m8pa1.
(The format of our PDB-style files is described here.)

Timeline for d1m8pa1: