Lineage for d1m8ca_ (1m8c A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430862Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 430863Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 430864Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 430896Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 430908Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (31 PDB entries)
  8. 430935Domain d1m8ca_: 1m8c A: [78769]
    mutant

Details for d1m8ca_

PDB Entry: 1m8c (more details)

PDB Description: solution structure of the t state of turkey ovomucoid at ph 2.5

SCOP Domain Sequences for d1m8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ca_ g.68.1.1 (A:) Ovomucoid domains {Turkey (Meleagris gallopavo)}
laavsvdcseypkdactleyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d1m8ca_:

Click to download the PDB-style file with coordinates for d1m8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ca_: