Lineage for d1m8ca_ (1m8c A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270322Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
    disulphide-rich small alpha+beta fold
  4. 270323Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
    two families share the same beta-sheet topology but differ in the active-site loop location
  5. 270324Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)
  6. 270351Protein Ovomucoid III domain [57469] (3 species)
  7. 270361Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (20 PDB entries)
  8. 270376Domain d1m8ca_: 1m8c A: [78769]
    mutant

Details for d1m8ca_

PDB Entry: 1m8c (more details)

PDB Description: solution structure of the t state of turkey ovomucoid at ph 2.5

SCOP Domain Sequences for d1m8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ca_ g.15.1.1 (A:) Ovomucoid III domain {Turkey (Meleagris gallopavo)}
laavsvdcseypkdactleyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d1m8ca_:

Click to download the PDB-style file with coordinates for d1m8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ca_: