Class a: All alpha proteins [46456] (226 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Arginine kinase, N-domain [48042] (1 species) |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries) |
Domain d1m80b1: 1m80 B:2-95 [78765] Other proteins in same PDB: d1m80a2, d1m80b2 mutant |
PDB Entry: 1m80 (more details), 2.35 Å
SCOP Domain Sequences for d1m80b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m80b1 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)} vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl dsgvgiyapdaesyrtfgplfdpiiddyhggfkl
Timeline for d1m80b1: