Lineage for d1m80b1 (1m80 B:2-95)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540796Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 540797Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 540798Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 540799Protein Arginine kinase, N-domain [48042] (1 species)
  7. 540800Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)
  8. 540807Domain d1m80b1: 1m80 B:2-95 [78765]
    Other proteins in same PDB: d1m80a2, d1m80b2
    mutant

Details for d1m80b1

PDB Entry: 1m80 (more details), 2.35 Å

PDB Description: substrate free form of arginine kinase

SCOP Domain Sequences for d1m80b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m80b1 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1m80b1:

Click to download the PDB-style file with coordinates for d1m80b1.
(The format of our PDB-style files is described here.)

Timeline for d1m80b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m80b2