Lineage for d1m80b1 (1m80 B:2-95)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445624Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 445625Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 445626Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 445627Protein Arginine kinase, N-domain [48042] (1 species)
  7. 445628Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)
  8. 445635Domain d1m80b1: 1m80 B:2-95 [78765]
    Other proteins in same PDB: d1m80a2, d1m80b2

Details for d1m80b1

PDB Entry: 1m80 (more details), 2.35 Å

PDB Description: substrate free form of arginine kinase

SCOP Domain Sequences for d1m80b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m80b1 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1m80b1:

Click to download the PDB-style file with coordinates for d1m80b1.
(The format of our PDB-style files is described here.)

Timeline for d1m80b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m80b2