SCOPe 2.07: Domain d1m7ta1: 1m7t A:1-106

Lineage for d1m7ta1 (1m7t A:1-106)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d1m7ta1: 1m7t A:1-106 [78745]
   Other proteins in same PDB: d1m7ta2
   human-escherichia coli thioredoxin chimera

Details for d1m7ta1

PDB Entry: 1m7t

PDB Description: solution structure and dynamics of the human-escherichia coli thioredoxin chimera: insights into thermodynamic stability

PDB Compounds: (A:) Chimera of Human and E. coli thioredoxin

SCOPe Domain Sequences for d1m7ta1:

Sequence; same for both SEQRES and ATOM records:

>d1m7ta1 c.47.1.1 (A:1-106) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1m7ta1:

• d1m7ta1 first appeared in SCOP 1.63, called d1m7ta_
  
• d1m7ta1 appears in SCOPe 2.06
  
• d1m7ta1 appears in the current release, SCOPe 2.08