SCOPe 2.01: Domain d1m6na1: 1m6n A:227-348

Lineage for d1m6na1 (1m6n A:227-348)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
   core: 4 helices: bundle; flanked by two short beta-hairpins
   duplication: consists of two structural repeats

4. Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family)

5. Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)

6. Protein Pre-protein crosslinking domain of SecA [81769] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
   Uniprot P28366

8. Domain d1m6na1: 1m6n A:227-348 [78697]
   Other proteins in same PDB: d1m6na2, d1m6na3, d1m6na4
   complexed with so4

Details for d1m6na1

PDB Entry: 1m6n, 2.7 Å

PDB Description: Crystal structure of the SecA translocation ATPase from Bacillus subtilis

PDB Compounds: (A:) Preprotein translocase secA

SCOPe Domain Sequences for d1m6na1:

Sequence; same for both SEQRES and ATOM records:

>d1m6na1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

Timeline for d1m6na1:

• d1m6na1 first appeared in SCOP 1.63
  
• d1m6na1 appears in SCOP 1.75
  
• d1m6na1 appears in SCOPe 2.02
  
• d1m6na1 appears in the current release, SCOPe 2.08