Lineage for d1m66a1 (1m66 A:198-357)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003700Family a.100.1.6: Glycerol-3-phosphate dehydrogenase [48197] (1 protein)
    automatically mapped to Pfam PF07479
  6. 2003701Protein Glycerol-3-phosphate dehydrogenase [48198] (2 species)
  7. 2003705Species Trypanosome (Leishmania mexicana) [TaxId:5665] [48199] (7 PDB entries)
    Uniprot O29390
  8. 2003709Domain d1m66a1: 1m66 A:198-357 [78689]
    Other proteins in same PDB: d1m66a2
    complexed with bcp, plm

Details for d1m66a1

PDB Entry: 1m66 (more details), 1.9 Å

PDB Description: Crystal Structure of Leishmania mexicana GPDH Complexed with Inhibitor 2-bromo-6-chloro-purine
PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1m66a1:

Sequence, based on SEQRES records: (download)

>d1m66a1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
tdtvgcevasavknvlaigsgvanglgmglnaraalimrglleirdltaalggdgsavfg
laglgdlqltcsselsrnftvgkklgkglpieeiqrtskavaegvatadplmrlakqlkv
kmplchqiyeivykkknprdaladllscglqdeglpplfk

Sequence, based on observed residues (ATOM records): (download)

>d1m66a1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
tdtvgcevasavknvlaigsgvanglgmglnaraalimrglleirdltaalggdgsavfg
laglgdlqltcsselsrnftvgkklgkglpieeiqravaegvatadplmrlakqlkvkmp
lchqiyeivykkknprdaladllscglqdeglpplfk

SCOPe Domain Coordinates for d1m66a1:

Click to download the PDB-style file with coordinates for d1m66a1.
(The format of our PDB-style files is described here.)

Timeline for d1m66a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m66a2