SCOP 1.69: Domain d1m63e_: 1m63 E:

Lineage for d1m63e_ (1m63 E:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families)

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)

6. Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56315] (3 PDB entries)

8. Domain d1m63e_: 1m63 E: [78680]
   Other proteins in same PDB: d1m63b_, d1m63c_, d1m63f_, d1m63g_

Details for d1m63e_

PDB Entry: 1m63, 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes

SCOP Domain Sequences for d1m63e_:

Sequence; same for both SEQRES and ATOM records:

>d1m63e_ d.159.1.3 (E:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens)}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic

Timeline for d1m63e_:

• d1m63e_ first appeared in SCOP 1.63
  
• d1m63e_ appears in SCOP 1.67
  
• d1m63e_ appears in SCOP 1.71
  
• d1m63e_ appears in the current release, SCOPe 2.08