Lineage for d1m63e_ (1m63 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998236Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 2998239Species Human (Homo sapiens) [TaxId:9606] [56315] (9 PDB entries)
  8. 2998249Domain d1m63e_: 1m63 E: [78680]
    Other proteins in same PDB: d1m63b_, d1m63c_, d1m63f_, d1m63g_
    complexed with ca, fe, zn

Details for d1m63e_

PDB Entry: 1m63 (more details), 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
PDB Compounds: (E:) serine/threonine protein phosphatase 2b catalytic subunit, alpha isoform

SCOPe Domain Sequences for d1m63e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m63e_ d.159.1.3 (E:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic

SCOPe Domain Coordinates for d1m63e_:

Click to download the PDB-style file with coordinates for d1m63e_.
(The format of our PDB-style files is described here.)

Timeline for d1m63e_: