Lineage for d1m63c_ (1m63 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959125Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 959126Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 959127Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 959128Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 959143Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (56 PDB entries)
    Uniprot P05092
  8. 959241Domain d1m63c_: 1m63 C: [78679]
    Other proteins in same PDB: d1m63a_, d1m63b_, d1m63e_, d1m63f_
    complexed with calcineurin and cyclosporin (chain D and H)
    complexed with ca, fe, zn

Details for d1m63c_

PDB Entry: 1m63 (more details), 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
PDB Compounds: (C:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1m63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m63c_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1m63c_:

Click to download the PDB-style file with coordinates for d1m63c_.
(The format of our PDB-style files is described here.)

Timeline for d1m63c_: