Lineage for d1m63a_ (1m63 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1680010Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 1680013Species Human (Homo sapiens) [TaxId:9606] [56315] (5 PDB entries)
  8. 1680018Domain d1m63a_: 1m63 A: [78677]
    Other proteins in same PDB: d1m63b_, d1m63c_, d1m63f_, d1m63g_
    complexed with ca, fe, zn

Details for d1m63a_

PDB Entry: 1m63 (more details), 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
PDB Compounds: (A:) serine/threonine protein phosphatase 2b catalytic subunit, alpha isoform

SCOPe Domain Sequences for d1m63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m63a_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
msepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesv
alriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyv
drgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydacmd
afdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfg
nektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfp
slitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgek
vtemlvnvlnic

SCOPe Domain Coordinates for d1m63a_:

Click to download the PDB-style file with coordinates for d1m63a_.
(The format of our PDB-style files is described here.)

Timeline for d1m63a_: