Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries) Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98 |
Domain d1m5vc_: 1m5v C: [78662] domain 1, complex with a ribozyme protein/RNA complex; complexed with ca, mpd |
PDB Entry: 1m5v (more details), 2.4 Å
SCOPe Domain Sequences for d1m5vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5vc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs satnalrsmqgfpfydkpmriqyaktdsdiiakm
Timeline for d1m5vc_: