Lineage for d1m5ea_ (1m5e A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162310Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2162319Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 2162331Domain d1m5ea_: 1m5e A: [78642]
    complexed with act, am1, zn

Details for d1m5ea_

PDB Entry: 1m5e (more details), 1.46 Å

PDB Description: x-ray structure of the glur2 ligand binding core (s1s2j) in complex with acpa at 1.46 a resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d1m5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ea_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d1m5ea_:

Click to download the PDB-style file with coordinates for d1m5ea_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ea_: