SCOPe 2.01: Domain d1m5ba_: 1m5b A:

Lineage for d1m5ba_ (1m5b A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries)

8. Domain d1m5ba_: 1m5b A: [78637]
   complexed with bn1, zn

Details for d1m5ba_

PDB Entry: 1m5b, 1.85 Å

PDB Description: x-ray structure of the glur2 ligand binding core (s1s2j) in complex with 2-me-tet-ampa at 1.85 a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d1m5ba_:

Sequence; same for both SEQRES and ATOM records:

>d1m5ba_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1m5ba_:

• d1m5ba_ first appeared in SCOP 1.63
  
• d1m5ba_ appears in SCOP 1.75
  
• d1m5ba_ appears in SCOPe 2.02
  
• d1m5ba_ appears in the current release, SCOPe 2.08