Lineage for d1m4td1 (1m4t D:3-268)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2524034Protein Biosynthetic thiolase [53905] (1 species)
  7. 2524035Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
    Uniprot P07097
  8. 2524058Domain d1m4td1: 1m4t D:3-268 [78623]
    complexed with gol, so4

Details for d1m4td1

PDB Entry: 1m4t (more details), 1.77 Å

PDB Description: biosynthetic thiolase, cys89 butyrylated
PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m4td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4td1 c.95.1.1 (D:3-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1m4td1:

Click to download the PDB-style file with coordinates for d1m4td1.
(The format of our PDB-style files is described here.)

Timeline for d1m4td1: