| Class g: Small proteins [56992] (66 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (4 proteins) |
| Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
| Species Mouse (Mus musculus) [TaxId:10090] [82925] (1 PDB entry) |
| Domain d1m4ma_: 1m4m A: [78605] complexed with zn |
PDB Entry: 1m4m (more details), 2.8 Å
SCOP Domain Sequences for d1m4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ma_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Mouse (Mus musculus)}
pqiwqlylknyriatfknwpfledcactpermaeagfihcptenepdlaqcffcfkeleg
wepddnpieehrkhspgcafltvkkqmeeltvseflkldrqraknkiaketn
Timeline for d1m4ma_: