Lineage for d1m4ma_ (1m4m A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038069Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 3038088Species Mouse (Mus musculus) [TaxId:10090] [82925] (1 PDB entry)
  8. 3038089Domain d1m4ma_: 1m4m A: [78605]
    complexed with zn
    has additional insertions and/or extensions that are not grouped together

Details for d1m4ma_

PDB Entry: 1m4m (more details), 2.8 Å

PDB Description: Mouse Survivin
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 5

SCOPe Domain Sequences for d1m4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ma_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Mouse (Mus musculus) [TaxId: 10090]}
pqiwqlylknyriatfknwpfledcactpermaeagfihcptenepdlaqcffcfkeleg
wepddnpieehrkhspgcafltvkkqmeeltvseflkldrqraknkiaketn

SCOPe Domain Coordinates for d1m4ma_:

Click to download the PDB-style file with coordinates for d1m4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ma_: