![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [82925] (1 PDB entry) |
![]() | Domain d1m4ma_: 1m4m A: [78605] complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m4m (more details), 2.8 Å
SCOPe Domain Sequences for d1m4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ma_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Mouse (Mus musculus) [TaxId: 10090]} pqiwqlylknyriatfknwpfledcactpermaeagfihcptenepdlaqcffcfkeleg wepddnpieehrkhspgcafltvkkqmeeltvseflkldrqraknkiaketn
Timeline for d1m4ma_: