Lineage for d1m26.3 (1m26 F:,E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422611Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2422675Protein Jacalin [51103] (2 species)
  7. 2422685Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 2422701Domain d1m26.3: 1m26 F:,E: [78470]
    complexed with a2g, gal

Details for d1m26.3

PDB Entry: 1m26 (more details), 1.62 Å

PDB Description: crystal structure of jacalin-t-antigen complex
PDB Compounds: (E:) Jacalin, alpha chain, (F:) Jacalin, beta chain

SCOPe Domain Sequences for d1m26.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1m26.3 b.77.3.1 (F:,E:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOPe Domain Coordinates for d1m26.3:

Click to download the PDB-style file with coordinates for d1m26.3.
(The format of our PDB-style files is described here.)

Timeline for d1m26.3: