| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family) ![]() |
| Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein) |
| Protein N-utilization substance G protein NusG, N-terminal domain [82681] (3 species) |
| Species Aquifex aeolicus [TaxId:63363] [82682] (4 PDB entries) interrupted by an insert beta-sandwich domain |
| Domain d1m1gc3: 1m1g C:5-50,C:132-190 [78411] Other proteins in same PDB: d1m1ga1, d1m1ga2, d1m1gb1, d1m1gb2, d1m1gc1, d1m1gc2, d1m1gd1, d1m1gd2 |
PDB Entry: 1m1g (more details), 2 Å
SCOPe Domain Sequences for d1m1gc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1gc3 d.58.42.1 (C:5-50,C:132-190) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
qvqelekkwyalqvepgkeneakenllkvleleglkdlvdevivpaXnkifpgyilikah
mndkllmaiektphvfrpvmvggkpvplkeeevqnilnqikrgvkp
Timeline for d1m1gc3: