SCOPe 2.05: Domain d1m1ga3: 1m1g A:9-50,A:132-190

Lineage for d1m1ga3 (1m1g A:9-50,A:132-190)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family)

5. Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein)

6. Protein N-utilization substance G protein NusG, N-terminal domain [82681] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [82682] (4 PDB entries)
   interrupted by an insert beta-sandwich domain

8. Domain d1m1ga3: 1m1g A:9-50,A:132-190 [78405]
   Other proteins in same PDB: d1m1ga1, d1m1ga2, d1m1gb1, d1m1gb2, d1m1gc1, d1m1gc2, d1m1gd1, d1m1gd2

Details for d1m1ga3

PDB Entry: 1m1g, 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)

PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1ga3:

Sequence; same for both SEQRES and ATOM records:

>d1m1ga3 d.58.42.1 (A:9-50,A:132-190) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
lekkwyalqvepgkeneakenllkvleleglkdlvdevivpaXnkifpgyilikahmndk
llmaiektphvfrpvmvggkpvplkeeevqnilnqikrgvkp

Timeline for d1m1ga3:

• d1m1ga3 first appeared in SCOP 1.63
  
• d1m1ga3 appears in SCOPe 2.04
  
• d1m1ga3 appears in SCOPe 2.06
  
• d1m1ga3 appears in the current release, SCOPe 2.08