Lineage for d1m1gb2 (1m1g B:191-248)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784536Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)
  6. 1784537Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)
  7. 1784538Species Aquifex aeolicus [TaxId:63363] [82074] (3 PDB entries)
  8. 1784544Domain d1m1gb2: 1m1g B:191-248 [78407]
    Other proteins in same PDB: d1m1ga1, d1m1ga3, d1m1gb1, d1m1gb3, d1m1gc1, d1m1gc3, d1m1gd1, d1m1gd3

Details for d1m1gb2

PDB Entry: 1m1g (more details), 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)
PDB Compounds: (B:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1gb2 b.34.5.4 (B:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqveki

SCOPe Domain Coordinates for d1m1gb2:

Click to download the PDB-style file with coordinates for d1m1gb2.
(The format of our PDB-style files is described here.)

Timeline for d1m1gb2: