![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries) |
![]() | Domain d1m1aa_: 1m1a A: [78387] Other proteins in same PDB: d1m1ab_, d1m1ac_, d1m1ad_, d1m1af_, d1m1ag_, d1m1ah_ protein/DNA complex; complexed with imt, mn |
PDB Entry: 1m1a (more details), 2.65 Å
SCOPe Domain Sequences for d1m1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1aa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1m1aa_: