SCOP 1.65: Domain d1m19d_: 1m19 D:

Lineage for d1m19d_ (1m19 D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries)

8. Domain d1m19d_: 1m19 D: [78382]
   Other proteins in same PDB: d1m19a_, d1m19b_, d1m19c_, d1m19e_, d1m19f_, d1m19g_

Details for d1m19d_

PDB Entry: 1m19, 2.3 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m19d_:

Sequence; same for both SEQRES and ATOM records:

>d1m19d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1m19d_:

• d1m19d_ first appeared in SCOP 1.63
  
• d1m19d_ appears in SCOP 1.67
  
• d1m19d_ appears in the current release, SCOPe 2.08