Lineage for d1m19d_ (1m19 D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279050Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 279080Protein Histone H2B [47119] (3 species)
  7. 279081Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries)
  8. 279086Domain d1m19d_: 1m19 D: [78382]
    Other proteins in same PDB: d1m19a_, d1m19b_, d1m19c_, d1m19e_, d1m19f_, d1m19g_

Details for d1m19d_

PDB Entry: 1m19 (more details), 2.3 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m19d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m19d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1m19d_:

Click to download the PDB-style file with coordinates for d1m19d_.
(The format of our PDB-style files is described here.)

Timeline for d1m19d_: