Lineage for d1m19b_ (1m19 B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279050Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 279136Protein Histone H4 [47125] (4 species)
  7. 279137Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (7 PDB entries)
  8. 279142Domain d1m19b_: 1m19 B: [78380]
    Other proteins in same PDB: d1m19a_, d1m19c_, d1m19d_, d1m19e_, d1m19g_, d1m19h_

Details for d1m19b_

PDB Entry: 1m19 (more details), 2.3 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m19b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m19b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1m19b_:

Click to download the PDB-style file with coordinates for d1m19b_.
(The format of our PDB-style files is described here.)

Timeline for d1m19b_: