Lineage for d1m0ic_ (1m0i C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604414Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
    automatically mapped to Pfam PF05367
  6. 1604415Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 1604416Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 1604427Domain d1m0ic_: 1m0i C: [78342]
    complexed with so4

Details for d1m0ic_

PDB Entry: 1m0i (more details), 2.55 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site
PDB Compounds: (C:) Endodeoxyribonuclease I

SCOPe Domain Sequences for d1m0ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0ic_ c.52.1.17 (C:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOPe Domain Coordinates for d1m0ic_:

Click to download the PDB-style file with coordinates for d1m0ic_.
(The format of our PDB-style files is described here.)

Timeline for d1m0ic_: