SCOPe 2.02: Domain d1m0ic_: 1m0i C:

Lineage for d1m0ic_ (1m0i C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)

6. Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
   forms dimer by swapping the common core elements

7. Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)

8. Domain d1m0ic_: 1m0i C: [78342]
   complexed with so4

Details for d1m0ic_

PDB Entry: 1m0i, 2.55 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site

PDB Compounds: (C:) Endodeoxyribonuclease I

SCOPe Domain Sequences for d1m0ic_:

Sequence; same for both SEQRES and ATOM records:

>d1m0ic_ c.52.1.17 (C:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

Timeline for d1m0ic_:

• d1m0ic_ first appeared in SCOP 1.63
  
• d1m0ic_ appears in SCOPe 2.01
  
• d1m0ic_ appears in SCOPe 2.03
  
• d1m0ic_ appears in the current release, SCOPe 2.08