Lineage for d1m0f2_ (1m0f 2:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 628310Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 628311Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 628312Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 628313Protein Bacteriophage alpha3 assembly [82950] (1 species)
  7. 628314Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry)
  8. 628316Domain d1m0f2_: 1m0f 2: [78334]

Details for d1m0f2_

PDB Entry: 1m0f (more details)

PDB Description: structural studies of bacteriophage alpha3 assembly, cryo-electron microscopy

SCOP Domain Sequences for d1m0f2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0f2_ i.6.1.1 (2:) Bacteriophage alpha3 assembly {Bacteriophage alpha3}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaee

SCOP Domain Coordinates for d1m0f2_:

Click to download the PDB-style file with coordinates for d1m0f2_.
(The format of our PDB-style files is described here.)

Timeline for d1m0f2_: