Lineage for d1m0f2_ (1m0f 2:)
- Root: SCOP 1.69
Class i: Low resolution protein structures [58117] (24 folds) 
Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) 
Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins) 
Protein Bacteriophage alpha3 assembly [82950] (1 species) Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry) 
Domain d1m0f2_: 1m0f 2: [78334]
Details for d1m0f2_
PDB Entry: 1m0f (more details)
PDB Description: structural studies of bacteriophage alpha3 assembly, cryo-electron microscopy
SCOP Domain Sequences for d1m0f2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0f2_ i.6.1.1 (2:) Bacteriophage alpha3 assembly {Bacteriophage alpha3}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaee
SCOP Domain Coordinates for d1m0f2_:
Click to download the PDB-style file with coordinates for d1m0f2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m0f2_:
- d1m0f2_ first appeared in SCOP 1.63
- d1m0f2_ appears in SCOP 1.67
- d1m0f2_ appears in SCOP 1.71
- d1m0f2_ appears in the current release, SCOPe 2.08
View in 3D
