|  | Class i: Low resolution protein structures [58117] (25 folds) | 
|  | Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) | 
|  | Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)  | 
|  | Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) | 
|  | Protein Bacteriophage alpha3 assembly [82950] (1 species) | 
|  | Species Bacteriophage alpha3 [TaxId:10849] [82951] (1 PDB entry) | 
|  | Domain d1m0f1_: 1m0f 1: [78333] | 
PDB Entry: 1m0f (more details), 16 Å
SCOPe Domain Sequences for d1m0f1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0f1_ i.6.1.1 (1:) Bacteriophage alpha3 assembly {Bacteriophage alpha3 [TaxId: 10849]}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra
Timeline for d1m0f1_: